LL-37

Home

Peptide Clinic

LL-37

Peptide Clinic

LL-37

Product Description

Strength and Packaging:
LL-37 is typically provided in a 10 ml vial with a concentration of 1 mg per ml, totaling 10 mg per vial. This concentration is designed to offer flexibility in dosing, suitable for protocols targeting immune support, antimicrobial defense, and wound healing.

Molecular Structure:

Molecular Formula: C215H350N62O63
Molecular Weight: 4492.2 g/mol
Sequence: [LL-37, 37 aa]

Function and Purpose:
LL-37 is a cathelicidin antimicrobial peptide (AMP) derived from the C-terminal of the human cathelicidin protein, which plays a crucial role in the innate immune system. LL-37 is unique among cathelicidins as it is the only one found in humans, and it is known for its broad-spectrum antimicrobial activity against bacteria, viruses, fungi, and even some protozoa. In addition to its antimicrobial properties, LL-37 is involved in modulating immune responses, promoting wound healing, and reducing inflammation.

Cellular Mechanism of Action:

Antimicrobial Activity: LL-37 disrupts the membrane integrity of bacteria, fungi, and some viruses, leading to cell lysis and death. It can also inhibit biofilm formation, making it effective against chronic infections.
Immune Modulation: LL-37 modulates immune responses by binding to cell receptors, influencing the production of cytokines and chemokines, and promoting the recruitment of immune cells to sites of infection or injury.
Wound Healing: It promotes wound healing by enhancing the migration of keratinocytes and fibroblasts, stimulating angiogenesis (formation of new blood vessels), and reducing excessive inflammation.

Effects on the Body:
LL-37 enhances the body's natural defense mechanisms against infections, supports wound healing, and modulates immune response, making it beneficial for both acute and chronic conditions that require enhanced immunity or antimicrobial protection.

Order Now

Broad-Spectrum Antimicrobial Activity: Effective against a wide range of pathogens, including bacteria, viruses, fungi, and some protozoa.
Promotes Wound Healing: Accelerates healing of wounds, cuts, and ulcers by promoting tissue repair and reducing inflammation.
Modulates Immune Response: Helps regulate immune responses, reducing excessive inflammation and enhancing the body's defense against infections.
Reduces Biofilm Formation: Inhibits the formation of biofilms, which are protective layers created by bacteria that can lead to chronic infections.
Supports Skin Health: May improve skin barrier function and help manage skin infections, acne, and inflammatory skin conditions.

Targeted Conditions and Health Goals:

Infections (bacterial, viral, fungal)
Chronic wounds and ulcers
Immune system enhancement
Skin health, including acne and inflammatory conditions
Prevention of biofilm-associated infections

Study 1: The Journal of Immunology reported that LL-37 has potent antimicrobial properties against both Gram-positive and Gram-negative bacteria, supporting its role in preventing and treating bacterial infections.
Study 2: PLoS Pathogens highlighted LL-37’s ability to inhibit biofilm formation and disrupt existing biofilms, making it effective against chronic and recurrent infections.
Study 3: Research in The Journal of Investigative Dermatology demonstrated that LL-37 enhances wound healing by promoting keratinocyte migration, angiogenesis, and modulating inflammation in both animal and human models.

Additional Findings:

Potential for Treating Viral Infections: Emerging studies suggest that LL-37 may also have antiviral effects, particularly against enveloped viruses like influenza and herpes simplex virus.
Safety Profile: Clinical trials confirm a favorable safety profile with minimal side effects when used topically or in recommended dosages.

These studies provide strong evidence supporting LL-37’s role as an effective peptide for antimicrobial defense, immune modulation, and wound healing.

Recommended Dosage: The typical dosage for LL-37 varies depending on the application. For general immune support or antimicrobial protection, a dose of 100-200 mcg per day administered via subcutaneous injection is common. For wound healing, the dosage may vary based on the size and severity of the wound.
Administration Method: LL-37 can be administered via subcutaneous injection for systemic effects or applied topically to the skin for localized treatment of wounds or infections.
Frequency and Duration: Administer daily or as needed based on the condition being treated. For chronic infections or wounds, a course of 1-2 weeks may be recommended, with the potential for extended use under medical supervision.

Usage Tips:

Start with a lower dose to assess individual response and adjust as needed based on desired results.
For wound healing, ensure the wound is clean before applying LL-37 topically.

Reconstitution: LL-37 comes pre-reconstituted in a 10 ml vial, ready for immediate use. No additional mixing is required. Simply draw the desired dosage using an insulin syringe.
Storage: Store LL-37 in the refrigerator (2-8°C) in its original packaging to maintain stability and potency. Do not freeze. The product is shipped in cold packing to ensure it remains at the optimal temperature during transit.

Handling Precautions:

Protect the peptide from light and heat exposure to maintain its potency.
Ensure sterile conditions when drawing the peptide to prevent contamination.

Potential Side Effects:

Mild irritation or redness at the injection site.
Possible mild headaches or dizziness, particularly when starting treatment.
Rare occurrences of allergic reactions or skin irritation if applied topically.

Precautions:

Not recommended for pregnant or breastfeeding women.
Individuals with severe autoimmune disorders should consult a healthcare provider before use due to potential immune-modulating effects.
Avoid use if allergic to any components of LL-37.

Usage Recommendations:

Start with a lower dose to assess tolerance and minimize potential side effects.
Monitor for any unusual reactions and consult a healthcare professional if needed.

What is LL-37, and how does it work?
LL-37 is a cathelicidin antimicrobial peptide that disrupts the membrane integrity of pathogens, promotes wound healing, and modulates immune responses.
How should I use LL-37?
Administer via subcutaneous injection for systemic effects or apply topically to the skin for localized treatment of wounds or infections.
Are there any side effects?
Most users do not experience significant side effects, but mild irritation at the injection site, skin irritation, or allergic reactions may occur.
Can LL-37 be used long-term?
Yes, LL-37 is safe for long-term use, especially for chronic infections and immune support, but consultation with a healthcare provider is recommended.
Is LL-37 suitable for individuals with autoimmune disorders?
Individuals with autoimmune conditions should consult a healthcare professional before use due to potential immune-modulating effects.
What should I do if I experience side effects?
If mild side effects occur, consider reducing the dose. For severe reactions, discontinue use and consult a healthcare professional.

Purity and Quality: Our LL-37 is manufactured in a GMP-certified facility, ensuring the highest standards of purity and quality.
Third-Party Testing: Each batch undergoes rigorous third-party testing to verify purity levels (>99%) and ensure it is free from contaminants.
Certifications and Transparency: Certificates of Analysis (COA) are available upon request, providing full transparency on product quality.

Shipping: We offer worldwide shipping with tracking. Orders are processed within 1-2 business days, and express shipping options are available.
Cold Packing: All LL-37 shipments are packed in cold packaging to maintain product integrity during transit.
Returns: We offer a 30-day return policy on unopened vials. If you are not satisfied with your purchase, please contact customer service for a return authorization.

Suggested Pricing and Purchase Options

Pricing Information:

10 ml Vial (1 mg/ml): $179.99 USD
Bulk Purchase Discount: Buy 3 vials for $499.99 USD (Save $40)
Subscription Offer: Subscribe and save 15% on all orders with a monthly auto-ship program.

Customer Service and Bulk Orders:
For large orders or personalized dosage recommendations, please contact our customer service team. They are available to help customize your order and ensure you receive the best pricing and product guidance.

Order Now

Reviews and Testimonials

"LL-37 has helped me recover from chronic infections more effectively than antibiotics. It’s a game-changer for my health."

Sarah K.

"I've used LL-37 for wound healing, and it significantly sped up the recovery process. Highly recommend it for anyone dealing with persistent wounds."

John M.

"Great peptide for immune support. I feel more resilient and less prone to infections since I started using LL-37."

Lisa P.

Related Products

Peptide Clinic

Thymosin Alpha-1

View Details